PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N03139.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BBR-BPC
Protein Properties Length: 368aa    MW: 41344.6 Da    PI: 10.321
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N03139.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind338.22.1e-10313431294
         GAGA_bind   1 mdddgsre..rnkg.yye....paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalll 86 
                       mdd+g+re  r+k+ + +    +++s+k     q+m  +aerda+i+ernla+sekk a+aerdma lqrd+a+aern+a++erdn++++l++
  Migut.N03139.1.p   1 MDDSGHREngRHKPpQGQwlmqQQPSMK-----QIMGFMAERDAAIQERNLAISEKKTALAERDMAILQRDSAIAERNNAIMERDNAIATLQY 88 
                       9999998878888732223332335555.....************************************************************ PP

         GAGA_bind  87 vensla......salpvgvqvlsgtksidslqqlse............pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpke 161
                       +en+++      s +p+g+q+ +g+k++++ qq+++            +++++s+++ ++++ +++++++++            + + ++p +
  Migut.N03139.1.p  89 RENAINssnnnmSPCPPGCQIPRGVKHMHHPQQHQQqqqqhihhhhhqSHMAESPYNNNNNSSNNNNNTRDNM-----------QMSDTVPIS 170
                       ***998888988899***************9995552333444444443333333333322222222222222...........223334444 PP

         GAGA_bind 162 kkakkkkkksekskkkvkkesader........................................skaekksidlvlngvslDestlPvPvCs 214
                       + a +++k++++++ k++k+ a                                            k ++k++dl+ln+v++Dest+PvPvCs
  Migut.N03139.1.p 171 PVAPEPTKTRRAKRAKEAKPAATAAprkasknskrvkreednnlndlnnlnkavfgkshdmelggPKLDWKDQDLGLNQVAFDESTMPVPVCS 263
                       4444444444444333333333211234555555666666778899*********************************************** PP

         GAGA_bind 215 CtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGt 294
                       CtG lr CYkWGnGGWqS+CCtt++S+yPLP+++++r+aR++grKmS++af+kl+++LaaeG+dlsnpvDLkdhWAkHGt
  Migut.N03139.1.p 264 CTGFLRPCYKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKHGT 343
                       *******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.4E-911343IPR010409GAGA-binding transcriptional activator
SMARTSM012268.8E-1421345IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDDSGHRENG RHKPPQGQWL MQQQPSMKQI MGFMAERDAA IQERNLAISE KKTALAERDM  60
AILQRDSAIA ERNNAIMERD NAIATLQYRE NAINSSNNNM SPCPPGCQIP RGVKHMHHPQ  120
QHQQQQQQHI HHHHHQSHMA ESPYNNNNNS SNNNNNTRDN MQMSDTVPIS PVAPEPTKTR  180
RAKRAKEAKP AATAAPRKAS KNSKRVKREE DNNLNDLNNL NKAVFGKSHD MELGGPKLDW  240
KDQDLGLNQV AFDESTMPVP VCSCTGFLRP CYKWGNGGWQ SSCCTTNLSM YPLPAVPNKR  300
HARVGGRKMS GSAFNKLISR LAAEGHDLSN PVDLKDHWAK HGTIATSLSN RKKKKKIHHL  360
MLMQDKK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083484.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083485.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083486.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083487.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083488.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083489.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083490.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083491.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083492.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083493.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083494.11e-172PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-140BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A022R8S90.0A0A022R8S9_ERYGU; Uncharacterized protein (Fragment)
STRINGGLYMA04G02860.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53532338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-121basic pentacysteine 6